PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00046865001
Common NameGSBRNA2T00046865001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 349aa    MW: 38723.6 Da    PI: 6.2526
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00046865001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.62.9e-091356340
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                         +r C+ + +k+++++C  ++ +lC++C +  H+       H++v
  GSBRNA2T00046865001 13 ARACDSCVKKRARWYCAADDAFLCQSCDTLVHSAnplarrHERV 56
                         578*****************************657888888876 PP

2CCT68.41.9e-23290333144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  GSBRNA2T00046865001 290 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 333
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.9E-101158IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8791158IPR000315B-box-type zinc finger
PfamPF006433.5E-81356IPR000315B-box-type zinc finger
CDDcd000218.63E-101458No hitNo description
PROSITE profilePS5101716.083290332IPR010402CCT domain
PfamPF062035.4E-18290332IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MKNLANAVGA KTARACDSCV KKRARWYCAA DDAFLCQSCD TLVHSANPLA RRHERVRLKS  60
ASPVATKYSS HNHSASSPPL EAATWHQGFT RKPRTPRGSG KKNNLSIFHD LVPEISAEDQ  120
TDSYEIEELL ICQVPVLDPM VAEQFLNDVI EPKIEFPMIT IDDQEDEDNA ESCLNGFFPT  180
DMELEEFAAD VEILLAMNMG IGCGEDRGDG DGTVKEEEQK NVLMLSLNYE SVISTWGGQG  240
QPWMSGEPPE RDIDISDKPV VSMEINGGES HHKHYVGGCL PSSGFGDGGR EARVSRYREK  300
RRTRLFSKKI RYEVRKLNAE KRPRMKGRFV KRASLALSAA SSPLGVNY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1300316RRTRLFSKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.228750.0leaf| vegetative meristem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587109.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
SwissprotQ8RWD00.0COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A078JII70.0A0A078JII7_BRANA; BnaC05g50730D protein
STRINGBra024750.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.10.0B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]